[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for huge0:KIAA1422


[Show Plain Result]

## Summary of Sequence Search
   1::1151
 256::424    4e-26 24.2% 0037417 00374171 1/1   ge-gated potassium channels             
 190::380  7.7e-26 24.3% 0041998 00419981 1/1   ge-gated potassium channels             
 250::378  4.2e-16 29.2% 0051014 00510141 1/1   ge-gated potassium channels             
 292::375  3.6e-14 35.0% 0040580 00405801 1/1   ge-gated potassium channels             
 131::377  8.2e-13 29.2% 0042184 00421841 1/1   ge-gated potassium channels             
 391::559  0.00067 21.9% 0047346 00473461 1/2   )-binding Rossmann-fold domains         
 819::953      9.1 18.3% 0047346 00473462 2/2   )-binding Rossmann-fold domains         
   1::1151


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           AREEGGGSHSLLPRVGSELPGRMPLPDGARTPGGVCREARGGGYTNRTFEFDDGQCAPRRPCAGDGALLD
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TAGFKMSDLDSEVLPLPPRYRFRDLLLGDPSFQNDDRVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLF
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ------------------------------------------------------------lrllrllkll
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NFSLKLLTCLLYIVRVLLDDPALGIGCWGCPKQNYSFNDSSSEINWAPILWVERKMTLWAIQVIVAIISF
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  -------------------------------------------------igygriaplfdlgilllilyn
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  rllrdlrtlllllrlrl.....................................................
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LETMLLIYLSYKGNIWEQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFLNCWLAKHALENMINDFHR
00374171   1/1  ---------------------------------------------lrllrllrllrllrllrttlglrrs
00419981   1/1  lvgiplellplldlgltlvllvldlvftviFtleillrlraa..glklrylr..wnilDllavlpsllll
00510141   1/1  ---------------------------------------lrvlrllrllrllkllrtlvrlr........
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ......................................................................
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIWPSQ
00374171   1/1  .........rrellllllllllllllgallfyliegdlgdslfwsfldalYfsivTltTvGYGDivPvtp
00419981   1/1  lllgsllllrvlrllrllrllrllrlfsglrrllrtllrslkal......pllllllllllllligallf
00510141   1/1  ........lrllllllllllllllllgallfyllegllgdslfwsfldalYfsvvTltTvGYGdivPvtp
00405801   1/1  -----------ellllllllllllllgallfyllegw....sfldalYfafvtltTvGYGdivPltllgr
00421841   1/1  ...........pllllllllllylllgallfyllegllgdslfwsfldafYfsfvTltTiGYGdivpvtp
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPR
00374171   1/1  lgrlfailyillGlllfalligligsllarpykrl...erlrfslrdhiillglnllpkvlveelreyge
00419981   1/1  ylleggigpsnfwsfldalyfsfvtltTvG----------------------------------------
00510141   1/1  lgrllailyillGlllialligliasll------------------------------------------
00405801   1/1  lfailyillGlllialllgllvsll---------------------------------------------
00421841   1/1  lgrlfailyillGlllialllgliaal-------------------------------------------
00473461   1/2  ----------------------------------------klkmhviiiGagrvGrslarlLlee.....
00473462   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LQDYYVVILCPTEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAAD
00374171   1/1  vlde------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ..gidvvvi...drdperveelaeelellgvlvivgdatdpevLeeagieeadavialtdd........d
00473462   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           HQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLALNCICPATSTLITLLVHTSR
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  eanlliallakelnpdlriiarardpeylelleklgadevispellaalllarlvlrplvvdvlelldg-
00473462   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GQEGQESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKREDNKSILL
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           NPGPRHILAASDTCFYINITKEENSAFIFKQEEKRKKRAFSGQGLHEGPARLPVHSIIASMGTVAMDLQG
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TEHRPTQSGGGGGGSKLALPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLSVVE
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           YVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFI
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ------------------------------------------------klkmhviiiGagrvGrslarlL


                         +         -         -         -         -         *         -:910
query           VPLRAYYRSRKELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDKEST
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  leeg.........idvvvidrdperveelaeelellgvlvivgdatdpevLeeagieeadavialtdd..


                         -         -         -         +         -         -         -:980
query           MSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSNLAF
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  .........deanlliallakelnpdlriiarardpeylelle---------------------------


                         -         *         -         -         -         -         +:1050
query           MFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTTPGSGYLCAMKITEGDLWIRTYGRLFQK
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           LCSSSAEIPIGIYRTESHVFSTSEPHDLRAQSQISVNVEDCEDTREVKGPWGSRAGTGGSSQGRHTGGGD
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           PAEHPLLRRKSLQWARRLSRKAPKQAGRAAA---------------------------------------
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------
00510141   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------