[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for huge0:KIAA1464


[Show Plain Result]

## Summary of Sequence Search
   1::621
  33::239  1.1e-44 28.6% 0052728 00527281 1/1   navalin A-like lectins/glucanases       
  28::226  2.3e-43 31.9% 0051761 00517611 1/1   navalin A-like lectins/glucanases       
   1::621


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           KMAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLS
00527281   1/1  --------------------------------llkapvlnllldllkelllyqvdvtldpntaspnlvls
00517611   1/1  ---------------------------dlkllilaekdpflsslldllldllslllk......gvvdvtl


                         -         -         *         -         -         -         -:140
query           QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
00527281   1/1  ednltvtl..rperfdgtacvlgsegfss..GrhyWEVevgskvrgtewavGvatesaplkgvlflsllG
00517611   1/1  dpntaspnlvlsedgltvtl...perfdstagvlgsegfs..sGrhyWEvevderlrggawvvGvatksa


                         +         -         -         -         -         *         -:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
00527281   1/1  sdsgsWglslsdgrlyhnsenlsvllygvgltylplfkvgdrigvlLDyeagtlsFykngkslgvafrgl
00517611   1/1  prkgvgfvallgsdsgsWglslydgrlwhngegkaltngpflsygplfgvgdvigvlLDleagtlsFykn


                         -         -         -         +         -         -         -:280
query           GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFAR
00527281   1/1  fggplyPavslvsggasvtlnfglspprf-----------------------------------------
00517611   1/1  gvslgvafrglfgepl------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
00527281   1/1  ----------------------------------------------------------------------
00517611   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSS
00527281   1/1  ----------------------------------------------------------------------
00517611   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SSSPSSVNYSESNSTDSTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDES
00527281   1/1  ----------------------------------------------------------------------
00517611   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQ
00527281   1/1  ----------------------------------------------------------------------
00517611   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH---------
00527281   1/1  ----------------------------------------------------------------------
00517611   1/1  ----------------------------------------------------------------------