[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD98844.1


[Show Plain Result]

## Summary of Sequence Search
   1::288
  16::285  PF06800 0.0% 42.2053231939163  Sugar transport protein 
 173::279  PF00892 0.0% 19.6261682242991  EamA-like transporter family 
   1::288


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNIIIALIPAVCWGIFPLIASKTGGGPANQILGTGLGATLVGLIVFAIMHPTITASAFIWAFMAGACWTI
PF06800         ---------------ipliaskiggkpeqqilGttlgalifalilalvkqpeltlslkilivslisGllw
PF00892         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKIIGLVALAIVVVGVILTAVTDD
PF06800         algQllqfkslk..lvgvskamPistglQLvgasLigvlvfgeWstsvqvilGllaliliiiGvvltslk
PF00892         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFATRETSALTARE
PF06800         ekkeakleesknlkkgilllllstigyviyvvlaql...vkvdglsallpqaiGmvigalilalak..kk
PF00892         --------------------------------lesvspltitayrlliagillilllfllrepialislk


                         -         -         -         +         -         -         -:280
query           SWAGMIGGAIWGIAAFAYIFSAQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRELGFTLAGLVLLVV
PF06800         klvekatllniisGllwaignlflllsaqkvGvatafslsQlgvvistlggilllgekktkkelvlvivG
PF00892         dilallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillG-


                         -         *         -         -         -         -         +:350
query           GSVITGFI--------------------------------------------------------------
PF06800         iilii-----------------------------------------------------------------
PF00892         ----------------------------------------------------------------------