[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD98845.1


[Show Plain Result]

## Summary of Sequence Search
   1::448
  50::249  PF06738 0.0% 29.1666666666667  Protein of unknown function (DUF1212) 
 314::397  PF06738 0.0% 32.1428571428571  Protein of unknown function (DUF1212) 
   1::448


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSGEEANSMLQSVMKHHHMQMPWHNFTPDNSNTPAKRATLKEKATLVGRVGIMLLSYGTGAWRVRDSMNA
PF06738         -------------------------------------------------aGrlLlqsGaetyrVedtmqr
PF06738         -------------------------------------------------aGrlLlqsGaetyrVedtmqr


                         -         -         *         -         -         -         -:140
query           IARELNISCSADVGLVSIEYTCVDEEGHGYTQALSLASTGVNTDKLSEMEQFVMDFNKGGSDLSSEQIHE
PF06738         iaralgvesvevfvtptaiiltv.dddeesittvrrvtdrginlqkltevnrlvraveh..geisleeaq
PF06738         iaralgvesvevfvtptaiiltv.dddeesittvrrvtdrginlqkltevnrlvraveh..geisleeaq


                         +         -         -         -         -         *         -:210
query           ILDEIERKPGHYTAIIAGLAAASACCAFVFLLGGGLVEMLCSFVGAGFGNYIRRKMIERRITLLACVSVS
PF06738         ekLdeikrkkpryprwlvvlaaglacaafavlfggdwidvliaflagllggllrvllakrklnpfvaeal
PF06738         ekLdeikrkkpryprwlvvlaaglacaafavlfggdwidvliaflagllggllrvllakrklnpfvaeal


                         -         -         -         +         -         -         -:280
query           VAVACIFYLIAFKSLVAIMHVSLQHEAGYIGAMLFVIPGFPFITSGLDIAKLDMRSGLERMMYAIMIITV
PF06738         aaflaaliallll.....slglganpdaiiigsillLvP-------------------------------
PF06738         aaflaaliallll.....slglganpdaiiigsillLvP-------------------------------


                         -         *         -         -         -         -         +:350
query           ATLVGWVVAMAVHLKPVNFIPLDLGVIPMMLLRIPASFVGVFGFSIMFNSTIEMATWAGIIGAIANTLRL
PF06738         ---------------------------------vlaaglacaafavlfggdwidvliaflagllggllrv
PF06738         ---------------------------------vlaaglacaafavlfggdwidvliaflagllggllrv


                         -         -         -         -         *         -         -:420
query           ELVDLTNIPAGAAAFTAALVAGLLASLIKGYPRISLTVPSIVIMVPGLYMYRAVYNIGVASINVGATWLT
PF06738         llakrklnpfvaealaaflaaliallllslglganpdaiiigsillL-----------------------
PF06738         llakrklnpfvaealaaflaaliallllslglganpdaiiigsillL-----------------------


                         -         -         +         -         -         -         -:490
query           EAALIVMFLPLGLITARILTDKKWRYKD------------------------------------------
PF06738         ----------------------------------------------------------------------
PF06738         ----------------------------------------------------------------------