[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD98850.1


[Show Plain Result]

## Summary of Sequence Search
   1::380
   4::376  PF01053 0.0% 53.887399463807  Cys/Met metabolism PLP-dependent enzyme 
  47::230  PF01041 0.0% 31.7919075144509  DegT/DnrJ/EryC1/StrS aminotransferase family 
  73::198  PF00266 0.0% 23.015873015873  Aminotransferase class-V 
  50::179  PF00155 0.0% 26.1904761904762  Aminotransferase class I and II 
  76::195  PF02347 0.0% 25.8620689655172  Glycine cleavage system P-protein 
 106::215  PF06838 0.0% 30.9090909090909  Aluminium resistance protein 
  50::196  PF01212 0.0% 21.3793103448276  Beta-eliminating lyase 
   1::380


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVAGFA
PF01053         ---dtlavhagqekdeaqtgavvvpiyatstykfksveeaalfageekgyeYsRsgnPtrevleeriaaL
PF01041         ----------------------------------------------ttgkeveeFEkafaeylgvkhava
PF00266         ----------------------------------------------------------------------
PF00155         -------------------------------------------------idglpeleealakflgrsekl
PF02347         ----------------------------------------------------------------------
PF06838         ----------------------------------------------------------------------
PF01212         -------------------------------------------------ktvarledavaellgkeaalf


                         -         -         *         -         -         -         -:140
query           FASGSAAIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
PF01053         eggeaalavsSGmaAiaaallallkaGdevvatddlYggtqrllekvlkklgvevkfvdtsdleelekai
PF01041         vssGtaAlllaLralgigpGdeVIvpsltfvAtanav....lqlGakpvfvDvdpetlnldpaaieaait
PF00266         --sgttealnlvalslarslkagdeilvteaehhanlvpwqelakrtgakvkvipvdeegsldldelekl
PF00155         klkreaavvvgsGagaliealifllklnpgdeilvpdp....tyasyknilrlsggevvryplyseedfh
PF02347         -----Amllaaraskkkkkkfvvdkkvhpqtlevlktrakgleieivvvdlkeekvsd...ekdvagvlv
PF06838         -----------------------------------qgslkdfgikykevdlleegkvdieavkeaikekt
PF01212         vpsGtaAnqialsallqreeevvvtep..shihfdetgaikelggvklvtlknkeagkldleklealike


                         +         -         -         -         -         *         -:210
query           ETPTNPLLQIADIAAITKIAKKHKLKTIVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
PF01053         kpntklvylEtptnpllkvvDieaiaklakkkgdvlvvvDntfaspllqrpLelgaDivvhSaTKylnGh
PF01041         prtkaI...lpVhlyGqpadmdairaiaaehglkvieDaAqAlGatykGkkvGtlgdaatfSffptKnl.
PF00266         ltpktklvaithvsnvtGvvqpveeiaklakeagalvvvDaaqavghipidvkklgvD------------
PF00155         ldlealeealkeapegnkktkvvlvesphNPtGtvatle-------------------------------
PF02347         qypnt.eGeiedlkelieeahkakvlvvvaadllaLtilkpPgelgaDivvGsaq---------------
PF06838         kliliqrskGyaerksltideikeiiklvkeineevivfvdncyGefvetkePtevGadliaGsliknpG
PF01212         vgaheenialisltitnntaGGqvvsleelreiaeiakeygiplhlDgARlaeaak--------------


                         -         -         -         +         -         -         -:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
PF01053         sdvvgGvvvvkgkeelakklkflqnalGavlspfdawlllrGlkTLslRverhsenAlklAefLekhpkv
PF01041         ..ttgeGGavvtdDpelaer--------------------------------------------------
PF00266         ----------------------------------------------------------------------
PF00155         ----------------------------------------------------------------------
PF02347         ----------------------------------------------------------------------
PF06838         Ggiak-----------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
PF01053         ekvyYpgLeshpqhelakkqlkgfggvlsfelkseeeaakkfldklklfslaeslGgvesLishpatmth
PF01041         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------
PF00155         ----------------------------------------------------------------------
PF02347         ----------------------------------------------------------------------
PF06838         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIG----------------------------------------
PF01053         asipkeereaagvtddLvRlsvGiEd--------------------------------------------
PF01041         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------
PF00155         ----------------------------------------------------------------------
PF02347         ----------------------------------------------------------------------
PF06838         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------