[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD98930.1


[Show Plain Result]

## Summary of Sequence Search
   1::362
  46::164  PF00005 0.0% 37.719298245614  ABC transporter 
 275::344  PF08402 0.0% 30.8823529411765  TOBE domain 
  69::204  PF02463 0.0% 27.4725274725275  RecF/RecN/SMC N terminal domain 
  18::63   PF03193 0.0% 26.6666666666667  Protein of unknown function, DUF258 
  37::184  PF00004 0.0% 26.5060240963855  ATPase family associated with various cellular acti 
   1::362


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRI
PF00005         ---------------------------------------------STLlklltgelkptegeievdndrk
PF08402         ----------------------------------------------------------------------
PF02463         --------------------------------------------------------------------ki
PF03193         -----------------tkegleelaellkd.ktsvlvGqSGvGKSsLinallpeldlkvgev-------
PF00004         ------------------------------------lyGppGtGKTllakavakelgve...........


                         -         -         *         -         -         -         -:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
PF00005         dlesdkleklrigyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldksrvstL
PF08402         ----------------------------------------------------------------------
PF02463         ngkevtkkevaellesagiske...........................................lLSgG
PF03193         ----------------------------------------------------------------------
PF00004         ....................................................fleisgsellskyvgese


                         +         -         -         -         -         *         -:210
query           QRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVL
PF00005         SgGqkqrvalArallkkpklllLD----------------------------------------------
PF08402         ----------------------------------------------------------------------
PF02463         ektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn..aQfivislreeml------
PF03193         ----------------------------------------------------------------------
PF00004         kkirelfkeakeka..psvlfiDEidalaksrgseseeeervvn--------------------------


                         -         -         -         +         -         -         -:280
query           NNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPE
PF00005         ----------------------------------------------------------------------
PF08402         ----------------------------------------------------------------laiRPE
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESE
PF00005         ----------------------------------------------------------------------
PF08402         klrlaagg.an.glsGtVedveylGsstryvvelaggqlvvvrqsnasrdsalapGdtVelswd------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EDFDARLDSYND----------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF08402         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------