[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD98951.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
  14::192  PF00881 0.0% 33.1034482758621  Nitroreductase family 
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNFKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
PF00881         -------------ksRrSiRkFddep.vpkedlekileaarlaPsagnlqpwrfvvitdeelkerlakla


                         -         -         *         -         -         -         -:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
PF00881         aealakaeaqaelllryrkkgnqklladapvlivv................................srt


                         +         -         -         -         -         *         -:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
PF00881         kdkkerksddrsyeyalldaglaaqnlllaAaalGlgscpiggfdeeeevre------------------


                         -         -         -         +         -         -         -:280
query           IEFQ------------------------------------------------------------------
PF00881         ----------------------------------------------------------------------