[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99160.1


[Show Plain Result]

## Summary of Sequence Search
   1::82
   1::79   PF01197 0.0% 56.7164179104478  Ribosomal protein L31 
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
PF01197         MKkgiHPeyrevvvtcascgnkfltrStk............eeplikvdvssesHPfytgkqklvdteGr


                         -         -         *         -         -         -         -:140
query           VDRFNKKYGFTN----------------------------------------------------------
PF01197         vekFkkrfg-------------------------------------------------------------