[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99183.1


[Show Plain Result]

## Summary of Sequence Search
   1::181
  62::127  PF04167 0.0% 43.9393939393939  Protein of unknown function (DUF402) 
   1::181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWITREPALVYFHK
PF04167         -------------------------------------------------------------dyalsffpe


                         -         -         *         -         -         -         -:140
query           HYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKRLLDVDEYEDHGNKWHYSADI
PF04167         gkwynvtvfldedgrlkgyYvNiatpteldedavkyvDldLDvvvrpdgeveilDed-------------


                         +         -         -         -         -         *         -:210
query           DKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSRQQ-----------------------------
PF04167         ----------------------------------------------------------------------