[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99233.1


[Show Plain Result]

## Summary of Sequence Search
   1::307
   3::295  PF00294 0.0% 34.4947735191638  pfkB family carbohydrate kinase 
 164::278  PF08543 0.0% 27.1929824561403  Phosphomethylpyrimidine kinase 
   1::307


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
PF00294         --tkiaviGealidliardekl..ekelvevkevekgaGGagaNvavalarLggevafigkvGddkfgef
PF08543         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
PF00294         lleelkkegvdtdyvkideetrtglalvlvdgdgertivfyrgaaadltpeelnedllaeadvlylsg..
PF08543         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
PF00294         .llseplpeatlealieaaknngkfdpnlrdplwssaleklrellpkadilkpNeeEaealtgekdedve
PF08543         -----------------------eeavealkeeLlplatlvtPNlpEaeaLlgrkikteedmkeaakkll


                         -         -         -         +         -         -         -:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
PF00294         evlaalkklkakgaklvvvtlGkkGallvekdgevhvppvpkvkvvDttGAGDafvagflaglla.gksl
PF08543         elgakavlvkGghlegeeavvtdvlydegeveeleaerietknthGtGCtlsaaiaaelakg.kslee--


                         -         *         -         -         -         -         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSK-------------------------------------------
PF00294         eealrlanavaalvv-------------------------------------------------------
PF08543         ----------------------------------------------------------------------