[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99245.1


[Show Plain Result]

## Summary of Sequence Search
   1::194
  35::120  PF06265 0.0% 59.3023255813954  Protein of unknown function (DUF1027) 
   1::194


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNSERKERREVQLAKKAETIEAAASEVLVINETRIKIDGRPYDLVENYHEGFSAERLGERFSQILTKYDY
PF06265         ----------------------------------vkideleyelvenvrdafdeeklkeryseilekyDy


                         -         -         *         -         -         -         -:140
query           IVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILHNLEVQTPEPIPANIRKKSSK
PF06265         ivgDwgyeqLrLkGfykdekkkaekdkkistledYlleycnfGcayfvlk--------------------


                         +         -         -         -         -         *         -:210
query           RKSQSSSKKHNSKNNVFTNEKRYNIRSQKNKKNAHLKSVSKKNTKHRHFTIRQK----------------
PF06265         ----------------------------------------------------------------------