[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99260.1


[Show Plain Result]

## Summary of Sequence Search
   1::146
  35::92   PF01047 0.0% 31.0344827586207  MarR family 
  38::135  PF03965 0.0% 21.875  Penicillinase repressor 
  38::107  PF01978 0.0% 25  Sugar-specific transcriptional regulator TrmB 
   1::146


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
PF01047         ----------------------------------ltltqfviLrilyesgplsvseLakklgvsrstvtr
PF03965         -------------------------------------lEaevmeivwelgeatvkevveeleeerelays
PF01978         -------------------------------------yEakvYlaLlkkgpatadeiaeelgvprskvye


                         -         -         *         -         -         -         -:140
query           TIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLED
PF01047         vldrLEkkGlieRskspeDrRe------------------------------------------------
PF03965         TVktllrrLvkKgllsreke..grafiYsplvseeeavasavkqlldrlfegsvkelvaafveee-----
PF01978         vLrsLekkGlverekgr..............pklYka---------------------------------


                         +         -         -         -         -         *         -:210
query           FLKEHS----------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF03965         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------