[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99261.1


[Show Plain Result]

## Summary of Sequence Search
   1::326
 238::326  PF08541 0.0% 52.8089887640449  3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 
 106::183  PF08545 0.0% 44.8717948717949  3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 
  49::170  PF08392 0.0% 23.9669421487603  FAE1/Type III polyketide synthase-like protein 
 220::325  PF02797 0.0% 30.188679245283  Chalcone and stilbene synthases, C-terminal domain 
  58::76   PF02803 0.0% 31.5789473684211  Thiolase, C-terminal domain 
 232::277  PF02803 0.0% 41.304347826087  Thiolase, C-terminal domain 
   1::326


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
PF08541         ----------------------------------------------------------------------
PF08545         ----------------------------------------------------------------------
PF08392         ------------------------------------------------eEaeevlfgavdellaktkvkp
PF02797         ----------------------------------------------------------------------
PF02803         ---------------------------------------------------------aikkalkkaGltv
PF02803         ---------------------------------------------------------aikkalkkaGltv


                         -         -         *         -         -         -         -:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
PF08541         ----------------------------------------------------------------------
PF08545         -----------------------------------fDvnaaCsgfvyalsvAaaliesgaaknvLvvgae
PF08392         kdigilvvnc.slfsptPslsamvvnryklredvksynLsGmGCsaglisidlakdllqvhkntlalvvs
PF02797         ----------------------------------------------------------------------
PF02803         edidlf----------------------------------------------------------------
PF02803         edidlf----------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRK
PF08541         ----------------------------------------------------------------------
PF08545         tlsrildwkdrstavlfGDGAgAvvleaseeegaeilssalgs---------------------------
PF08392         tEnitlnwYvGnersmllsnclFRvGgaav----------------------------------------
PF02797         ----------------------------------------------------------------------
PF02803         ----------------------------------------------------------------------
PF02803         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
PF08541         ---------------------------ekagltpedidwfvphqanlriidavakrlglpeekvvvnlde
PF08545         ----------------------------------------------------------------------
PF08392         ----------------------------------------------------------------------
PF02797         ---------dvpeliskniekalkealeklgisdwnslfWiahpGGpaildqveakleLkpeklkasrev
PF02803         ---------------------aikkalkkaGltvedidlfEinEAFaaqalavakeldldlekvNvn---
PF02803         ---------------------aikkalkkaGltvedidlfEinEAFaaqalavakeldldlekvNvn---


                         -         *         -         -         -         -         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY------------------------
PF08541         yGntsaasiplaLdeaveegklkpgdlvllvgfGaGlswgaavlrw------------------------
PF08545         ----------------------------------------------------------------------
PF08392         ----------------------------------------------------------------------
PF02797         lseyGnlssacvlfildelrkkslkegkkttgeGlewGvllgfGP-------------------------
PF02803         ----------------------------------------------------------------------
PF02803         ----------------------------------------------------------------------