[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99301.1


[Show Plain Result]

## Summary of Sequence Search
   1::448
 266::288  PF07261 0.0% 43.4782608695652  Replication initiation and membrane attachment prot 
 308::385  PF07261 0.0% 28.3783783783784  Replication initiation and membrane attachment prot 
   1::448


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDSALNKLSPKDGYLVSASTYIDNHDIEIVQVLYQPIIGIVAVALYSYLRFEIDSKLILSERKLNKNIID
PF07261         ----------------------------------------------------------------------
PF07261         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GLGISIPELYDARLKLEATGLIKTFEGEDKLGKYHIYELQKPLNEVKFFTDDLLSTALLEMVGNEKFKKL
PF07261         ----------------------------------------------------------------------
PF07261         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SLWNKFDNNYHDKKEVTKQFFDVFNLNKDNIVLQAQLNNSKISNDESLINRQKVSLDMTVFSDFIKNSYV
PF07261         ----------------------------------------------------------------------
PF07261         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SSDDVMNHLDIIKSVKLVYGIDEFQLVKLLEKAINVTNNKIDYNEFKKLAQKNFDSGIRRNFKKNKIVET
PF07261         -------------------------------------------------------ekILrnWkkkgikTv
PF07261         -------------------------------------------------------ekILrnWkkkgikTv


                         -         *         -         -         -         -         +:350
query           AKAKDDEKDKNIDPLVNAFKAYVPLEFLEILKNELGSFVTANERYAVKTLVEKQMLPNEVINVLIHYLLV
PF07261         eqakayek-------------------lelfeqelgrplspieieeieewldedklspelinealkeav.
PF07261         eqakayek-------------------lelfeqelgrplspieieeieewldedklspelinealkeav.


                         -         -         -         -         *         -         -:420
query           VQDSSTILKGTFERIAADWTKKKIKNAQEAMTYVKSFTREKSLQRKATKKDSKGRKSNVIVKEKLPEWAK
PF07261         ennkrs...lkYiekILrnWkkkgikTveqakaye-----------------------------------
PF07261         ennkrs...lkYiekILrnWkkkgikTveqakaye-----------------------------------


                         -         -         +         -         -         -         -:490
query           EKGKNKLTDVGKKENKEIDELLKKINGK------------------------------------------
PF07261         ----------------------------------------------------------------------
PF07261         ----------------------------------------------------------------------