[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99303.1


[Show Plain Result]

## Summary of Sequence Search
   1::649
 277::446  PF00587 0.0% 31.547619047619  tRNA synthetase class II core domain (G, H, P, S an 
 550::638  PF03129 0.0% 38.2022471910112  Anticodon binding domain 
   4::63   PF02824 0.0% 35  TGS domain 
 175::221  PF07973 0.0% 35  Threonyl and Alanyl tRNA synthetase second addition 
   1::649


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ---irvytpdGkvpdlprgstveDfAykIhrslakkfiyAlVnGqrvglshvLedgDvVeIvt-------
PF07973         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVLWRTAAQVLANALHELYPNMKFGMGDVTEHGFYFDTDNSESQVAETDFEKISQKMSEIIKANLPIERV
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EFSEEEALNLVSGDEYQEELVRDVANKNNGRVVAYKQGDFIDITDGVVLSSTGEVKIFKLLSVAGAYWKG
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------vsiGdvsvelCgGtHvpnTgeIgafkil.......s


                         -         -         -         +         -         -         -:280
query           ASSNPMLQRIYGTAFYKQKDLDAELQRQKEARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVI
PF00587         ------------------------------------------------------------------knni
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         eesiakglrRI-----------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHK
PF00587         iqawreefieeegflevdtPiltpeevlkasGhvdkfademykvkdtge.eelyLrPetaqgiflnfkkl
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD
PF00587         lesnyrklPfklaqigkvfRnEi.sprsGllRvReFtqaeieifvdpekseeeleellalikefleklgl
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMGLEYFEAEGEAAFYGPKIDVQTKTALGGEETLS
PF00587         eklrfrqstrgelahyakdtwdlevw--------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TIQLDFLLPERFDLKYIGADGEEHRPVMVHRGIVSTMERFTAYLTEMYKGAFPTWLAPHQVDIIPVKNDL
PF00587         ----------------------------------------------------------------------
PF03129         -----------------------------------------------------------qvvviplgeka
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           HMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTNTMT
PF00587         ----------------------------------------------------------------------
PF03129         eeledyakklaeeLreagirvelddrsesigkklrradllgipfavvvGekelekgtvtvrdrdtgeker
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KAEFKNLLFEDIENYSREK---------------------------------------------------
PF00587         ----------------------------------------------------------------------
PF03129         vsleelve--------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------