[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99339.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
   3::60   PF08207 0.0% 72.4137931034483  Elongation factor P (EF-P) KOW-like domain 
 129::184  PF09285 0.0% 58.9285714285714  Elongation factor P, C-terminal 
  67::119  PF01132 0.0% 50.9433962264151  Elongation factor P (EF-P) OB domain 
  65::119  PF01287 0.0% 31.4814814814815  Eukaryotic elongation factor 5A hypusine, DNA-bindi 
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKM
PF08207         --sasdfkkGlvieidgnpwrvvefehvkpGkgsAfvrtklrnlltGnivektFrsgekv----------
PF09285         ----------------------------------------------------------------------
PF01132         ------------------------------------------------------------------erem
PF01287         ----------------------------------------------------------------Vkrkey


                         -         -         *         -         -         -         -:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGI
PF08207         ----------------------------------------------------------------------
PF09285         ----------------------------------------------------------veleVvetepav
PF01132         qYlYkdgdnyvFMdtetYEqielskealgdaakfLkEgmevtvllynge---------------------
PF01287         qLidisdDgfvsLmd.edgetkeDlklPegelaeeikekfeegkevlVt---------------------


                         +         -         -         -         -         *         -:210
query           KGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGTYISRA-------------------------
PF08207         ----------------------------------------------------------------------
PF09285         kGdtassstKpAtLetGlevqVPlFIeeGekIkvdTrtgeYvsR--------------------------
PF01132         ----------------------------------------------------------------------
PF01287         ----------------------------------------------------------------------