[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99372.1


[Show Plain Result]

## Summary of Sequence Search
   1::260
  30::254  PF01255 0.0% 48.868778280543  Putative undecaprenyl diphosphate synthase 
   1::260


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPRIAGHKQGMETVKNITKVASNLGVKV
PF01255         -----------------------------ImDGNrRwakkkgletaeGheaGaealkevleiclelgvkv


                         -         -         *         -         -         -         -:140
query           LTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNC
PF01255         vtvYafSieNfkRskeEveaLmellkekleelleelellengvkvrviGdlsllpedvreaiekaeektk


                         +         -         -         -         -         *         -:210
query           TGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERI
PF01255         nnkkltlnialsYtsreeivdavkkllekvekgkleeeeiteetiekklytadl.p...pDlliRtsGee


                         -         -         -         +         -         -         -:280
query           SNFLLWQLAYSEFVFTDTLWPDYSEEDLLANIYTFQTRDRRFGRLKEEKK--------------------
PF01255         RLSdFllwqiayaelyfldklWPefkledllralleyqlrerrf--------------------------