[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99378.1


[Show Plain Result]

## Summary of Sequence Search
   1::375
   4::124  PF08529 0.0% 58.6776859504132  NusA N-terminal domain 
  47::97   PF00575 0.0% 16.2162162162162  S1 RNA binding domain 
 135::194  PF00575 0.0% 26.6666666666667  S1 RNA binding domain 
 251::279  PF07650 0.0% 28.5714285714286  KH domain 
 305::355  PF07650 0.0% 20  KH domain 
 251::265  PF00013 0.0% 26.6666666666667  KH domain 
 306::340  PF00013 0.0% 37.1428571428571  KH domain 
   1::375


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEVYD
PF08529         ---elleaieaiakeKgidkevvieaieeaLlkaykkkygeeenvrveidrktgeievfrrkeVveeved
PF00575         ----------------------------------------------Vdlgngvegfipiseissd.....
PF00575         ----------------------------------------------Vdlgngvegfipiseissd.....
PF07650         ----------------------------------------------------------------------
PF07650         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTG
PF08529         pdkeisleeakeidpeaevGdeieeevepedfgRiaaqtakqviiqklreaere----------------
PF00575         .........rvedpeevlkvgdevevk-------------------------------------GevvkG
PF00575         .........rvedpeevlkvgdevevk-------------------------------------GevvkG
PF07650         ----------------------------------------------------------------------
PF07650         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQ
PF08529         ----------------------------------------------------------------------
PF00575         tVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdk----------------
PF00575         tVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdk----------------
PF07650         ----------------------------------------------------------------------
PF07650         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPA
PF08529         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF07650         ----------------------------------------IGkgGsnikklrkelrkr.ievvegskvf-
PF07650         ----------------------------------------IGkgGsnikklrkelrkr.ievvegskvf-
PF00013         ----------------------------------------IGkgGsnIkeIeeet---------------
PF00013         ----------------------------------------IGkgGsnIkeIeeet---------------


                         -         *         -         -         -         -         +:350
query           EYIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNV
PF08529         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF07650         ------------------------vivviresrpgivIGkgGsnikklrkelrkrievvegskvf.....
PF07650         ------------------------vivviresrpgivIGkgGsnikklrkelrkrievvegskvf.....
PF00013         -------------------------rvlvpsskigriIGkgGsnIkeIeeetgakIdvpk----------
PF00013         -------------------------rvlvpsskigriIGkgGsnIkeIeeetgakIdvpk----------


                         -         -         -         -         *         -         -:420
query           EADNNDIDDEDQLMSDSSSNIIEEE---------------------------------------------
PF08529         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF07650         .Vkkv-----------------------------------------------------------------
PF07650         .Vkkv-----------------------------------------------------------------
PF00013         ----------------------------------------------------------------------
PF00013         ----------------------------------------------------------------------