[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99438.1


[Show Plain Result]

## Summary of Sequence Search
   1::112
   3::92   PF04297 0.0% 55.5555555555556  Putative helix-turn-helix protein, YlxM / p13 like 
  20::52   PF04545 0.0% 27.2727272727273  Sigma-70, region 4 
  32::84   PF05043 0.0% 25  Mga helix-turn-helix domain 
   1::112


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
PF04297         --lektlrlnaLfdiYqsLLTekqanylelyyadDlSlsEiAeefnvsrqavydnikrtekllekyEekL
PF04545         -------------------LpererevlelrfgeglTleEiGerlgisrerV------------------
PF05043         -------------------------------eeeevsleelaqelyiSestlyrkikklnklLkefdlel


                         -         -         *         -         -         -         -:140
query           HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE----------------------------
PF04297         kllekykkreellekikdkllk------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF05043         .tkkknqivGdEeq--------------------------------------------------------