[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99450.1


[Show Plain Result]

## Summary of Sequence Search
   1::565
  17::172  PF00753 0.0% 25.503355704698  Metallo-beta-lactamase superfamily 
 352::391  PF07521 0.0% 42.5  RNA-metabolising metallo-beta-lactamase 
   1::565


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
PF00753         ----------------vnsyLvegdggaiLiDtGlgteaaeall.......lallglgpkdidaiilTHa
PF07521         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
PF00753         HaDHiGGlpglleafpapvvygaeearallrlalrdvlkrkkpvrallpdvdeevddgilggrrllfvtg
PF07521         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTEIGREGVLALLSESANAENPRETVNERAIYD
PF00753         hpghgpghgvvylgggkvlftGDllfaagtgr--------------------------------------
PF07521         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FISENFEYRKGRIIVACVASNILRVQQIFNAAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPI
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KKINDYNDDEIVILETGRSGEPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSG
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
PF00753         ----------------------------------------------------------------------
PF07521         -pvkarveqlhfSGHAdqeeLlellkllkpekvilVHGEpe-----------------------------


                         -         -         +         -         -         -         -:490
query           YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDTPKITSRGFVY
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTKRHPVILPVIMEINQNNHFSK
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KKKKG-----------------------------------------------------------------
PF00753         ----------------------------------------------------------------------
PF07521         ----------------------------------------------------------------------