[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99526.1


[Show Plain Result]

## Summary of Sequence Search
   1::75
  26::71   PF06855 0.0% 60.8695652173913  Protein of unknown function (DUF1250) 
   1::75


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
PF06855         -------------------------LAndafqDsnFPkqskdydeissYLelnasylssmeifdrawelY


                         -         -         *         -         -         -         -:140
query           EEFMS-----------------------------------------------------------------
PF06855         l---------------------------------------------------------------------