[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99636.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
  85::237  PF00849 0.0% 35.7615894039735  RNA pseudouridylate synthase 
  13::58   PF01479 0.0% 41.304347826087  S4 domain 
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
PF00849         ----------------------------------------------------------------------
PF01479         ------------RLDkvLarlglassrseArqlIehGhVrVNGkvvkdpsyrVkpgDv------------


                         -         -         *         -         -         -         -:140
query           EPENIPLDIVYEDDDVIVVNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
PF00849         --------------dlvvvnKPagvpvtpeakggsekeksttatssrae..eekkelklvhRLDkaTsGl
PF01479         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
PF00849         lllAksgeaaaklakafeerkvrKkYlalvfgapleeegaikskiskdtekqegarrkkeeldgkkavty
PF01479         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
PF00849         lrvlesgsktpksnasakvtlvelele-------------------------------------------
PF01479         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TAPLPENFKKLLESLDKR----------------------------------------------------
PF00849         ----------------------------------------------------------------------
PF01479         ----------------------------------------------------------------------