[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99672.1


[Show Plain Result]

## Summary of Sequence Search
   1::375
   8::362  PF03054 0.0% 51.5669515669516  tRNA methyl transferase 
   7::79   PF02540 0.0% 29.2307692307692  NAD synthase 
 168::187  PF02540 0.0% 35  NAD synthase 
   5::77   PF02568 0.0% 32.8767123287671  Thiamine biosynthesis protein (ThiI) 
   8::88   PF00733 0.0% 21.6216216216216  Asparagine synthase 
   1::375


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKDKSQIRVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPY
PF03054         -------kvvvalSgGVDSsvaalllkeqgyevigvfmknweeedeegkeccaeedlkdaervaeklgip
PF02540         ------kgvvlGlSGGvDSalvaalavkalgkenvlalimP..s......svsseedvedalalaeklgi
PF02540         ------kgvvlGlSGGvDSalvaalavkalgkenvlalimP..s......svsseedvedalalaeklgi
PF02568         ----tqgkvlaLlSgGiDSpVaaylllkRGcevvlvhfkneplkseeaeekvrklaellaeyktelevkl
PF00733         -------pvgvlLSGGlDSsliaalaaresskplktfsvgfeesead.......eagyaelvaehlgteh


                         -         -         *         -         -         -         -:140
query           YSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRV
PF03054         levvnfekeykekvfeefleeykkGrTPnPdvlCNkeiKfgallekakeelgadalatGHYarvsleeek
PF02540         esktidike-------------------------------------------------------------
PF02540         esktidike-------------------------------------------------------------
PF02568         vvvdfkk---------------------------------------------------------------
PF00733         veinvteeellealpevi----------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKF
PF03054         nevellraldkkkDQsyfLsqlskeqlekllfPlgeltKeevrkiAkeaglevaekkdSqgiCFigkrkf
PF02540         ---------------------------lapiaellKtevyeLakrln-----------------------
PF02540         ---------------------------lapiaellKtevyeLakrln-----------------------
PF02568         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNE
PF03054         kdflkkyleekeGkiidietgevlgeheGllsyTiGqrkGlklgg...leeplyVvekdaeknevvvskg
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HLYANSLDASKLSFVDDISDCGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVF
PF03054         edkeallskellvkelnwlaeelkekealevevkvrhrqeevkakvklked.eevevklkekvravtpGQ
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YDGEECLGSGTIDHAYKESKLLQYV---------------------------------------------
PF03054         aavlYkgdevLG----------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------