[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99736.1


[Show Plain Result]

## Summary of Sequence Search
   1::252
 171::240  PF00583 0.0% 15.7142857142857  Acetyltransferase (GNAT) family 
 135::169  PF08445 0.0% 30.3030303030303  FR47-like protein 
 186::242  PF08445 0.0% 25  FR47-like protein 
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKPNLNLITTAVD
PF00583         ----------------------------------------------------------------------
PF08445         ----------------------------------------------------------------------
PF08445         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIEKLPPEFQIHSIDANLYDQCL
PF00583         ----------------------------------------------------------------------
PF08445         ----------------------------------------------------------------laawil
PF08445         ----------------------------------------------------------------laawil


                         +         -         -         -         -         *         -:210
query           QKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQL
PF00583         ------------------------------gelvGfaslsvigedgraertayieglaVspeyrgqGiGk
PF08445         rkdg.gel.galqvlpehrrrGlgsrlvk----------------gelgalqvlpehrrrGlgsrlvkal
PF08445         rkdg.gel.galqvlpehrrrGlgsrlvk----------------gelgalqvlpehrrrGlgsrlvkal


                         -         -         -         +         -         -         -:280
query           IITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYEIEE----------------------------
PF00583         aLleallekarerglerielevesgndrai----------------------------------------
PF08445         akeiae.rgktvllvvvasNtpsirlyeklGf--------------------------------------
PF08445         akeiae.rgktvllvvvasNtpsirlyeklGf--------------------------------------