[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99739.1


[Show Plain Result]

## Summary of Sequence Search
   1::578
  67::333  PF01979 0.0% 28.75  Amidohydrolase family 
  67::80   PF07969 0.0% 42.8571428571429  Amidohydrolase family 
 294::331  PF07969 0.0% 42.1052631578947  Amidohydrolase family 
  16::57   PF00449 0.0% 40  Urease alpha-subunit, N-terminal domain 
   1::578


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
PF01979         ------------------------------------------------------------------ivlP
PF07969         ------------------------------------------------------------------lvlP
PF07969         ------------------------------------------------------------------lvlP
PF00449         ---------------eealDlvitnalilDa..tGivkadigikdGrivaiGkagnp-------------


                         -         -         *         -         -         -         -:140
query           GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
PF01979         GlIDaHvHleqsllreedsyeaiktgakealrsGtTtvldtp.tsants.val.................
PF07969         GFvDsHtHld------------------------------------------------------------
PF07969         GFvDsHtHld------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
PF01979         ......rkeideglaaapklealvelllkgevggraelgevvidraageeeeiegadlikvieaggkgak
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
PF01979         aidgvlpalaphdaqtvskeelkaevelaeeeeekeklgllvhihaaeasgekevvehltgkspverldh
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
PF01979         llllknaikggvtllahclhlddeairllkergsgvahcplsnesvlhregrk-----------------
PF07969         -------------erlsleealalyTrgpAkalgledrkGtlevGkdADlv-------------------
PF07969         -------------erlsleealalyTrgpAkalgledrkGtlevGkdADlv-------------------
PF00449         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SQGNEYLGEVNYYPIDSVESSMHVKDFTREKLQLHLNSDKVRAIGVVPGEVLTTEEHVTVKRDGDGNFVY
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NDQEDVTKIVVVERHHNTGNVNVNLLSGYGIKAGAIAISIGHDSHNIIATGTNDDDIFMAVNELIKQEGG
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AVVVKDEKVISRMELKIAGLMCNLPAEKMIAQQDALDEAVHEELGVPDNVNPVMTLSFMPLAVIPKLKIT
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DKGLVDVEKNAFVSNELD----------------------------------------------------
PF01979         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------