[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99766.1


[Show Plain Result]

## Summary of Sequence Search
   1::102
   1::95   PF00829 0.0% 62.1052631578947  Ribosomal prokaryotic L21 protein 
   1::102


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAKK
PF00829         myAiiktggkQykVeegdvikvekleaevgekieldkvLlvgkdekvkiGkplvegakVkaevlehgrgk


                         -         -         *         -         -         -         -:140
query           VVTFKYKPKKHQHTKQGHRQPYTKVVIDAINA--------------------------------------
PF00829         kvivfkykrrknyrkkqGhrqeltk---------------------------------------------