[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99824.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
   8::230  PF00563 0.0% 21.2264150943396  EAL domain 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNSTLNIAPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLE
PF00563         -------enkelslvfQPivdlstgk...vvgyEallrwkhpeggvispeeflplaerlgliaeldrlll


                         -         -         *         -         -         -         -:140
query           IKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGY
PF00563         ekalaqlaelakkasldpdlklsvnlspasllsdefleqllelleaglparrlvlEisesdl....desl


                         +         -         -         -         -         *         -:210
query           RVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDD
PF00563         ellealarLrslGirlalddfgtgysslsrlael..ppdviKidrsll.kdls.dpearallkalialar


                         -         -         -         +         -         -         -:280
query           VAAKEMLCHNIKLQQGFFWQVPQDYISPKEVHNFKEFE--------------------------------
PF00563         elgikviaegVeteeqlell--------------------------------------------------