[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99837.1


[Show Plain Result]

## Summary of Sequence Search
   1::586
 389::512  PF00005 0.0% 40.5405405405405  ABC transporter 
 379::393  PF02463 0.0% 53.3333333333333  RecF/RecN/SMC N terminal domain 
 441::555  PF02463 0.0% 28.5714285714286  RecF/RecN/SMC N terminal domain 
  32::204  PF00664 0.0% 17.3913043478261  ABC transporter transmembrane region 
 262::284  PF00664 0.0% 26.0869565217391  ABC transporter transmembrane region 
   1::586


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKKIPLLQELKKDTWVKPFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRPENILLVYVPI
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         -------------------------------lilagvtalvfplllgrllds..vsdgnde..ersslys
PF00664         -------------------------------lilagvtalvfplllgrllds..vsdgnde..ersslys


                         -         -         *         -         -         -         -:140
query           VLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSEDINHIQNL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         lail.liavgvlivlllqgsfyllertgqrirkrlfrallr...kilglfdsffdknsvGellsrltnDv
PF00664         lail.liavgvlivlllqgsfyllertgqrirkrlfrallr...kilglfdsffdknsvGellsrltnDv


                         +         -         -         -         -         *         -:210
query           YLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIMLVAFPIWSVIVNGARQEYEKKIKNELYLDL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         skirdglgdklg....lffqslatfvgglivmfylgwkltlvllailpllilvsavlakilksl------
PF00664         skirdglgdklg....lffqslatfvgglivmfylgwkltlvllailpllilvsavlakilksl------


                         -         -         -         +         -         -         -:280
query           TDNIVGITDWIFAQRGRDYVKLHEQNEEKLMDVQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGS
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ---------------------------------------------------isylsyalalwfgtflsvi
PF00664         ---------------------------------------------------isylsyalalwfgtflsvi


                         -         *         -         -         -         -         +:350
query           NGVYTGLANWIAAFVLCLFPVVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         sgel------------------------------------------------------------------
PF00664         sgel------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
PF00005         --------------------------------------STLlklltgelkptegeievdn.drkdlesdk
PF02463         ----------------------------aivGpNGSGKsnvld---------------------------
PF02463         ----------------------------aivGpNGSGKsnvld---------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
PF00005         leklr..igyipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........srvst
PF02463         --------------------eykingkevtkkevaellesagiske.................lLSgGek
PF02463         --------------------eykingkevtkkevaellesagiske.................lLSgGek
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTI
PF00005         LSgGqkqrvalArallkkpkll------------------------------------------------
PF02463         tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekadk-----
PF02463         tLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekadk-----
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EMQGSPDYLRKTNERYQKLKAIDEGR--------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------