[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99842.1


[Show Plain Result]

## Summary of Sequence Search
   1::323
  31::71   PF01476 0.0% 32.5  LysM domain 
   1::323


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLNKTLLSLTAATGIIATGAAANGAKADKITVKSSDTVSQLALDHATTVDNVQQLNNLENVDLIFVGQT
PF01476         ------------------------------ytVkkGDTLwkIAsryglseqeltelNeeldspr.lavGq


                         -         -         *         -         -         -         -:140
query           LEMGDGSYTTTTYQTASQYQQNYAQNTDAQANYTQTDYSAAQNNVPAATDQVQDTTTTVDQTATPADTTT
PF01476         k---------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QDAQTNVASDTTTSEVQVDATNTDQAATTTNDAVSTGATTTQAQAEVQAPATTTYVENTPAEAPTTTWTD
PF01476         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTSSVNNTVANTNSNYSSASTTPAATTTATQNTTTSSTSSDEDAAREWIANKESGGSYTAKNGIYYGKYQ
PF01476         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTATYLNGDYSAENQEKVANEYVASRYGSWTAAKAHWEANNWY---------------------------
PF01476         ----------------------------------------------------------------------