[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99890.1


[Show Plain Result]

## Summary of Sequence Search
   1::183
   5::180  PF03352 0.0% 54.8571428571429  Methyladenine glycosylase 
   1::183


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKCAWIYGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
PF03352         ----wa.kkdplyveYhDeeWGvpvrddqklfelLvLegaqaglsWltiLkkreafreaFagfdvekvak


                         -         -         *         -         -         -         -:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGIINNQPIINNFKNPEEIPTKTK
PF03352         lteedverlledkgiirnrlKieaviknArailklqeefgsfseylwsfvdkkpiknkvksleevpakte


                         +         -         -         -         -         *         -:210
query           LSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCYGRN---------------------------
PF03352         esealskdLkkrGfkfvGptivyafmqavGlvndHledcf------------------------------