[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABD99944.1


[Show Plain Result]

## Summary of Sequence Search
   1::170
   4::147  PF00588 0.0% 26.8115942028986  SpoU rRNA Methylase family 
   1::170


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
PF00588         ---ivvldeiedpgNlGaiaRtaaafgaselilvkprsvdllnkkakrasagalellelkvvdsleealk


                         -         -         *         -         -         -         -:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
PF00588         dlkeeglkviatsl.kgkslreielk...ekvalvfGnEdkGlsnellekad.elvkIpm.sgeveSLNv


                         +         -         -         -         -         *         -:210
query           TAAIVVYEALRQQGFPNLETTHTYENDKLK----------------------------------------
PF00588         avAvail---------------------------------------------------------------