[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00014.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
 158::226  PF00156 0.0% 32.3076923076923  Phosphoribosyl transferase domain 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLCNDCIKWKNNN
PF00156         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KILLNNKSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPSKDWIYIPIPVDEYTMQHRGF
PF00156         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NQVEGLIGDLPYSRVLKMKKLKRDKKQSEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQ
PF00156         -----------------rkssapassetsrkreaailesrpeedlkgk....rvliVDDvlatGgTlraa


                         -         -         -         +         -         -         -:280
query           ELLLKNGASRVCSVTLAR----------------------------------------------------
PF00156         ielLkeagakevgvav------------------------------------------------------