[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00071.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   2::96   PF03807 0.0% 38.7096774193548  NADP oxidoreductase coenzyme F420-dependent 
   1::80   PF03446 0.0% 32.8947368421053  NAD binding domain of 6-phosphogluconate dehydrogen 
   2::107  PF01210 0.0% 21.5686274509804  NAD-dependent glycerol-3-phosphate dehydrogenase N- 
   1::100  PF01408 0.0% 20.2020202020202  Oxidoreductase family, NAD-binding Rossmann fold 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
PF03807         -kigiiGaGnigealakglaaagaqkheviiaasrspekaeelaeelgvkvtavsneeaaeeadvvilav
PF03446         kkigfiGlGvMGsnmarnllkagyk...vavydrtkekveelvae.gaeaaesieefvasldvvilmvpa
PF01210         -kvavlGaGswGtalAkvlaeng...hevrlWvreeklieeinerrenvkylpgiklpenlvattDleea
PF01408         lrvgivGaGkigsrhlrplnesqrreelvalvdpdperaeavaesfgveaysdleelledpkidavivat


                         -         -         *         -         -         -         -:140
query           IVVEKVLKEVKDSVLTHDPVLVSVVTGVSVAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
PF03807         kpedveevlael..kealkgklvisv--------------------------------------------
PF03446         gkavdevieg------------------------------------------------------------
PF01210         lkgadiivlvVPsqflrevlkklkgll.kkdailvsl---------------------------------
PF01408         pngthadlakaaleagk.hvlvEKPlattv----------------------------------------


                         +         -         -         -         -         *         -:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
PF03807         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01408         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKG----------------
PF03807         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01408         ----------------------------------------------------------------------