[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00097.1


[Show Plain Result]

## Summary of Sequence Search
   1::807
  92::796  PF00343 0.0% 51.8571428571429  Carbohydrate phosphorylase 
   1::807


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDFNKEVFKEKFKNRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
PF00343         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
PF00343         ---------------------alkelgldleelleeekdaglGnGGlGrlaaCfldslatlglpalGyGl


                         +         -         -         -         -         *         -:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
PF00343         ryeyGlfkqkivdgkqveepddWlekgnpWeieredvalkvefyGkve..ekegkk.lkwedtevvlala


                         -         -         -         +         -         -         -:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
PF00343         ydlpipGyktkavntlrlWsakaseefnlakfneGdylaaveekekaenisrvlyPndntleGkelrlkq


                         -         *         -         -         -         -         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
PF00343         eyflvaaslqdiirrfkkskkkleeladkvaiqlndthPalaipellrilideeklsWdeaweittktfa


                         -         -         -         -         *         -         -:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
PF00343         ytnhtvlpealekWpvellekllPrhlqiieeinerflklveekypgdvdklrrlsiieegeekrvrmah


                         -         -         +         -         -         -         -:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
PF00343         lavvgshavnGvaklhsdllkkkvfkdfaelfPekfqnktnGitprrWlklanPelaalltkslgdewvk


                         *         -         -         -         -         +         -:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
PF00343         dlellkklkefaddealkeevkevkqenklrlaeyiekelgvevnpealfdvqvkriheykrqllnvlhv


                         -         -         -         *         -         -         -:630
query           ASDFQPRVFIFGAKAAPSYYYAKAIIKCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
PF00343         iarykeikeese.kkvvPrvvilggkaapgyylakkiiklinsvadvvnndpkvgdklkvvflenysvsl


                         -         +         -         -         -         -         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN
PF00343         aekiiPaadlseqistagteasGtsnmkfalnGaltiGtldGanveiaeevGeenlfifGarveeveklr


                         -         -         -         -         +         -         -:770
query           NHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLV
PF00343         kkg.ykekeyyekdkrleevleqiesgafspedkdefkdlldsllqagdeylvladfesyvdaqekvdel


                         -         -         *         -         -         -         -:840
query           NIAYGGMFSSDDTIKRYAEDIWNISPLKDEKHGTYSL---------------------------------
PF00343         ykdrekWtkksilniaasgkfssdrt--------------------------------------------