[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00173.1


[Show Plain Result]

## Summary of Sequence Search
   1::195
  34::124  PF04307 0.0% 44.9275362318841  Predicted membrane-bound metal-dependent hydrolase 
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQAKTHITTTLALGLPLMSLTNELTLVNVGVLAVGSLLPDIDHPSSYLGKRHKMVSGVTNKAFGHRGITH
PF04307         ---------------------------------lgallPDiDhpl.llkalvkstisrelgl.ssa....


                         -         -         *         -         -         -         -:140
query           SLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVKWLYPFTKSGSSFGGKFAFYK
PF04307         ..HRgftHsllfallla..............llllllffalgylsHlllDlltp----------------


                         +         -         -         -         -         *         -:210
query           TGQLSEYLVMGFMLCLLLMEVRLFWLGNLNRLLPGVVADILKTLILKVQDILNSY---------------
PF04307         ----------------------------------------------------------------------