[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00183.1


[Show Plain Result]

## Summary of Sequence Search
   1::618
   7::385  PF00999 0.0% 26.6666666666667  Sodium/hydrogen exchanger family 
 549::613  PF02080 0.0% 33.8461538461538  TrkA-C domain 
 405::516  PF02254 0.0% 25.9259259259259  TrkA-N domain 
   1::618


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVSFLIVTLAAFITPMVLARFKVSFLPTSVAEIIIGIIIGKSCFNLIHADTLLSWCSTFGVILLMFLSG
PF00999         ------llvllallagllarrlk...lpevvglilaGlllGpsglglvepsleldlevlaelglplllFl
PF02080         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MEIDFSLFKKNSHTLSPLEAKMAANEPKTSPVRAATYAYAFSLVASLILALLFKVTGLFSDVGLATILFS
PF00999         aGleldlrelrkngks................illlallgvlisflliGlllallllilglslleallfg
PF02080         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TVSLGIMTSLLKENELLSRPFGQTILLFSVLGEVIPMIALTAYSSIYAGKGASLWLITLLFIAAAFLFNR
PF00999         allsatdpvvvlavlkeegrvnkrlgtlilgesvlnDavavvllavlialaeeagglsdlglliliflvv
PF02080         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FRHFFSFFDKINKATTQIDMRLAFFVIIALVLVAETVGAENILGAFVAGIVLKLLEPAEETEHRLDAIGY
PF00999         algglllglviglllrlltkftsgdrelevllvlllallaallaevlglsgilgaflaGlvlseyefsne
PF02080         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GFFTPFFFILTGVNLDIPSLMRSPKTLLLIPLFFVAFILAKLPGYFGFQRRFSKKNSFVGAVATSTTITL
PF00999         lseklepfgkflfeplfFvlvGlsldlkvlltnglsllllvllllvaillgkllgvfllsrllglslrea
PF02080         ----------------------------------------------------------------------
PF02254         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVTTLKIAEHLHAITPQQSGAFLLAGILTCIVGPVFFNKQYKPEPEDQKQTSLHIIGVNLVTVSAAQQLS
PF00999         liigflglqrgavalalaalglslglisrelfall-----------------------------------
PF02080         ----------------------------------------------------------------------
PF02254         ------------------------------------------------------iiGlGrvGrslaeeLs


                         -         -         +         -         -         -         -:490
query           KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKLSLAAKKYGVN
PF00999         ----------------------------------------------------------------------
PF02080         ----------------------------------------------------------------------
PF02254         egekdvvvidkdeerveelreeglevvvgdatdeevLeeagiesadaviaatgddeanllavllarelnp


                         *         -         -         -         -         +         -:560
query           RVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQILTSSESRLYEVVVNDSIFVGV
PF00999         ----------------------------------------------------------------------
PF02080         ----------------------------------------------------------evtvpegsplvG
PF02254         kkkiiaraqdeeh....akllkkaga--------------------------------------------


                         -         -         -         *         -         -         -:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESAYFRRKLQRRNE------------
PF00999         ----------------------------------------------------------------------
PF02080         ktlkelnlrerygvlvvairRggeviiprgdtvLepGDvllvvgspedlaela-----------------
PF02254         ----------------------------------------------------------------------