[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00227.1


[Show Plain Result]

## Summary of Sequence Search
   1::180
  86::178  PF00673 0.0% 64.5161290322581  ribosomal L5P family C-terminus 
  25::81   PF00281 0.0% 60.7142857142857  Ribosomal protein L5 
   1::180


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
PF00673         ----------------------------------------------------------------------
PF00281         ------------------------NvmevPklekivvntgvGEagen.kiLekaakeleeisGQkPvitk


                         -         -         *         -         -         -         -:140
query           AKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
PF00673         ---------------igvkvtLrgekmyefLekllkvvlprirdfrglskksfDksGnfsfGikeqiifp
PF00281         akksiasFkir-----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK------------------------------
PF00673         eikydkvdkifGmditivttaktdkearallkelgipf--------------------------------
PF00281         ----------------------------------------------------------------------