[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00229.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
   1::122  PF00238 0.0% 64.7540983606557  Ribosomal protein L14p/L23e 
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPGGVVKKGDVVKAVVVRTKYGTH
PF00238         miqkktrlkvaDNSgakkvecIkvlgkkkkkaakvGDiivvsvkkaapkgkvkkgdvvkavvVrtkkevr


                         -         -         *         -         -         -         -:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL------------------
PF00238         rkdgsvikfddNavVlinkkgeplgtrifgpvarelrkkkflkilslAsevl------------------