[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00286.1


[Show Plain Result]

## Summary of Sequence Search
   1::296
  85::236  PF00849 0.0% 33.7748344370861  RNA pseudouridylate synthase 
   1::296


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFTWNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
PF00849         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
PF00849         --------------dlvvvnKPagvpvtpeakggsekeksttat.ssraeeekkelklvhRLDkaTsGll


                         +         -         -         -         -         *         -:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
PF00849         llAksgeaaaklakafeerkvrKkYlalvfgapleeegaikskiskdtekqegarrkkeeldgkkavtyl


                         -         -         -         +         -         -         -:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
PF00849         rvlesgsktpksnasakvtlvelele--------------------------------------------


                         -         *         -         -         -         -         +:350
query           SEMPKDLENLIVRLKN------------------------------------------------------
PF00849         ----------------------------------------------------------------------