[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00290.1


[Show Plain Result]

## Summary of Sequence Search
   1::273
  42::238  PF07859 0.0% 24.1935483870968  alpha/beta hydrolase fold 
  85::120  PF00326 0.0% 27.7777777777778  Prolyl oligopeptidase family 
 181::242  PF00326 0.0% 30  Prolyl oligopeptidase family 
  96::121  PF01738 0.0% 30.7692307692308  Dienelactone hydrolase family 
 194::259  PF01738 0.0% 26.6666666666667  Dienelactone hydrolase family 
  86::124  PF02230 0.0% 25.6410256410256  Phospholipase/Carboxylesterase 
 192::235  PF02230 0.0% 22.7272727272727  Phospholipase/Carboxylesterase 
   1::273


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQKITEKITVAGHTAELMGYTIEKKNDWGVQDKHATIIICPGGGYHFVSDREADPVALKLITMGYNAFVL
PF07859         -----------------------------------------GGGfvlgsldthdalcrrlakelgavvvs
PF00326         ----------------------------------------------------------------------
PF00326         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------
PF01738         ----------------------------------------------------------------------
PF02230         ----------------------------------------------------------------------
PF02230         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
PF07859         vdYrlAPehrfPaavedalaalrwlaeqawelgadpsrivvaGdSaGGnLaaavalrardrgepe.....
PF00326         --------------fdDfiaaaealakegyvdpdrlaitGgSyGGylvga--------------------
PF00326         --------------fdDfiaaaealakegyvdpdrlaitGgSyGGylvga--------------------
PF01738         -------------------------lkslpevstkkvgvvGfClGGalall-------------------
PF01738         -------------------------lkslpevstkkvgvvGfClGGalall-------------------
PF02230         ---------------aekieelidaelktgipssriilgGFSQGaalalylalt----------------
PF02230         ---------------aekieelidaelktgipssriilgGFSQGaalalylalt----------------


                         +         -         -         -         -         *         -:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
PF07859         ....iaaqvliyPgtdlertesesrelaeeaadgplltrdamdlfwrlylpeadrdhplaspllasdlsg
PF00326         ----------------------------------------lspyspadnvk..aypplllihGeeDdrvp
PF00326         ----------------------------------------lspyspadnvk..aypplllihGeeDdrvp
PF01738         -----------------------------------------------------pilahlgeeDpfipaea
PF01738         -----------------------------------------------------pilahlgeeDpfipaea
PF02230         ---------------------------------------------------lakvpilllHGeeDpvvpl
PF02230         ---------------------------------------------------lakvpilllHGeeDpvvpl


                         -         -         -         +         -         -         -:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRPEDIEPQAAQWVDLFHSWMQALLK-------
PF07859         lpptlvvvaelD..plrdegeayaerlr------------------------------------------
PF00326         paealklvaaLqkagknvlllifpdegHgigk--------------------------------------
PF00326         paealklvaaLqkagknvlllifpdegHgigk--------------------------------------
PF01738         aedleealakankdlelkiYpgagHaFaadsre......sydeaaaeda---------------------
PF01738         aedleealakankdlelkiYpgagHaFaadsre......sydeaaaeda---------------------
PF02230         algkaakellkkllnkvelkeyegm---------------------------------------------
PF02230         algkaakellkkllnkvelkeyegm---------------------------------------------