[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00302.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
   3::189  PF00300 0.0% 43.6708860759494  Phosphoglycerate mutase family 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
PF00300         --rlylvRHGeselnkegrlqgwsdvpLtekGreqarelgkkLkradlqidavytSplkRaiqTaeille


                         -         -         *         -         -         -         -:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
PF00300         eld...ipiiqeprLrerdfgeweglpkaevkeelpeeyekwkrdkkefrpp..................


                         +         -         -         -         -         *         -:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
PF00300         .......egesladvyeRvapfleelie.akdkgenvlivsHggvlral---------------------


                         -         -         -         +         -         -         -:280
query           PVVYDLDDKLNIVNKEKL----------------------------------------------------
PF00300         ----------------------------------------------------------------------