[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00312.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
  96::229  PF07702 0.0% 32.089552238806  UTRA domain 
   6::67   PF00392 0.0% 38.7096774193548  Bacterial regulatory proteins, gntR family 
  31::69   PF01978 0.0% 23.0769230769231  Sugar-specific transcriptional regulator TrmB 
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
PF07702         ----------------------------------------------------------------------
PF00392         -----yeqvyeeLredIlsgelrpGdkLPsereLaaefgVsrttvReALrrLeaeglverrqgrGtf---
PF01978         ------------------------------deiaeelgvprskvyevLrsLekkGlverekgrpklYka-


                         -         -         *         -         -         -         -:140
query           YLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
PF07702         -------------------------grkpktevlsleevpapaelaeaLglppgepvlrieRlryadgep
PF00392         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
PF07702         valeesylpaelvpdlleedleegslyayleeelglritraeetiearlataeeaelLgiepgapvlvie
PF00392         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IFFLDNGTPFEFSQMRLHFKYLKFNTFINLD---------------------------------------
PF07702         rvtydadgrpveysesyyr---------------------------------------------------
PF00392         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------