[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00338.1


[Show Plain Result]

## Summary of Sequence Search
   1::801
 198::524  PF02129 0.0% 43.4615384615385  X-Pro dipeptidyl-peptidase (S15 family) 
   1::154  PF09168 0.0% 52.2875816993464  X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal 
 552::791  PF08530 0.0% 31.2820512820513  X-Pro dipeptidyl-peptidase C-terminal non-catalytic 
   1::801


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
PF02129         ----------------------------------------------------------------------
PF09168         MkynqfayiktdfeealeELkkigfl.dleelstekanletflkrsfpeakteaakkeklsellateetd
PF08530         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
PF02129         ----------------------------------------------------------------------
PF09168         lltfleskqeltaevFylvalQlLgFeaevDfdlkdplaflkkialpvskeildkeeliealYqLLntrt
PF08530         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGQNLLDILANRGYFTQFYQLNLTEPIFFNGKAQPVFDTNKLIHEVVYVESELDTDQDGKRDLLKVIITR
PF02129         ---------------------------------------------------------DG..vrLavdiyr
PF09168         knGqtliDqLvskG--------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PAMTDNGMKVPTIFTASPYYLGTNDASAEKMMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
PF02129         P.etkskkklPvlltrtpYn..ksdelaatlasalgekelqdka..........................
PF09168         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
PF02129         ....................fvarGYavVvvdvrGtgaSeGeftvgsedevedgadvidWlak.......
PF09168         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EANKAIPAWWSNGKVAMTGKSYLGTLATAAATTGVAGLETIISEAAISSWYDYYREGGLVIAPGGFPGED
PF02129         ........qpwsnGkVGmtGiSYdGttqlaaaatgvpalkaivpesaisdlydeyyregGlvrapggltw
PF09168         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
PF02129         edldllaealesrradegdalkaaaryeaagdellkkqdretkvlselletgdydafwkernlsedadkv
PF09168         ----------------------------------------------------------------------
PF08530         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
PF02129         kvpvllvsGwnDwnvk.rgviklyealkesgske------------------------------------
PF09168         ----------------------------------------------------------------------
PF08530         -------------------------------------------------------------gverlppvr


                         -         -         -         *         -         -         -:630
query           VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
PF02129         ----------------------------------------------------------------------
PF09168         ----------------------------------------------------------------------
PF08530         lqdndgedpwrteddwpspattattlyls..........qrglsstaggtlstaspssddgaaakevlyd


                         -         +         -         -         -         -         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
PF02129         ----------------------------------------------------------------------
PF09168         ----------------------------------------------------------------------
PF08530         pdqreeradvltfttaplaedteivGapkvkLrvssdapdadlsvkLvdvgpd..............gra


                         -         -         -         -         +         -         -:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
PF02129         ----------------------------------------------------------------------
PF09168         ----------------------------------------------------------------------
PF08530         .....................klitkGilrlsnrksleeaepltPgeiydvtleLqptaytfpkGhrlrl


                         -         -         *         -         -         -         -:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPIEE---------------------------------------
PF02129         ----------------------------------------------------------------------
PF09168         ----------------------------------------------------------------------
PF08530         eisssdfphtdrnpstetltl-------------------------------------------------