[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00427.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
  41::169  PF00005 0.0% 38.7931034482759  ABC transporter 
  18::209  PF02463 0.0% 28.7292817679558  RecF/RecN/SMC N terminal domain 
  16::126  PF01637 0.0% 23.1578947368421  Archaeal ATPase 
  16::48   PF03193 0.0% 37.5  Protein of unknown function, DUF258 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
PF00005         ----------------------------------------STLlklltgelkptegeievdn....drkd
PF02463         -----------------ktvilpfsk.sftaivGpNGSGKsnvldAilFvLGeksakklrseklsdlihk
PF01637         ---------------ELkeleeilerepnsiiviyGprrsGKTaLlkeileelkekgkrvvyyinlreef
PF03193         ---------------gleelaellkd.ktsvlvGqSGvGKSsLinall----------------------


                         -         -         *         -         -         -         -:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
PF00005         lesdkleklr..igyipqdpllfpeltvrenldmakeekk.......tdkrieevlekvgldelldksrv
PF02463         ..skskakvksaeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevaellesagiske
PF01637         eskleefieeeeekkklakal............gialpkaeleeilk....kkskl--------------
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSALDPELELEVLKVLLQLAKEKQSLIIVTHNLAFAQKVADKI
PF00005         stLSgGqkqrvalArallkkpklllLDEP-----------------------------------------
PF02463         ......lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQf.ivisl-
PF01637         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLSNLD--------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF01637         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------