[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00428.1


[Show Plain Result]

## Summary of Sequence Search
   1::231
  18::41   PF00528 0.0% 41.6666666666667  Binding-protein-dependent transport system inner me 
  53::222  PF00528 0.0% 19.1358024691358  Binding-protein-dependent transport system inner me 
   1::231


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MWHTVISSLPELISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFYVWLFRSTPLL
PF00528         -----------------kvvlPnalppiitglilafggllg-----------ldkllrpliivlsslPsf
PF00528         -----------------kvvlPnalppiitglilafggllg-----------ldkllrpliivlsslPsf


                         -         -         *         -         -         -         -:140
query           VQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAAITSIPKGQWEAAASIGMTHK
PF00528         vlaillvlvf.......vilsilg.hlilpviillllsaapyvrlirraalrslpkdlveaaralGasrw
PF00528         vlaillvlvf.......vilsilg.hlilpviillllsaapyvrlirraalrslpkdlveaaralGasrw


                         +         -         -         -         -         *         -:210
query           QALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVEMFEVSQQIAAENYEPLVMYCTVAVLYAILC
PF00528         qifrkvvlPnalppiitglilafggllggavlleflgswpGlgtllleailgydyseisnggvlalviav
PF00528         qifrkvvlPnalppiitglilafggllggavlleflgswpGlgtllleailgydyseisnggvlalviav


                         -         -         -         +         -         -         -:280
query           TVLSFLQGWLEKVTSRYVATQ-------------------------------------------------
PF00528         lllnlvadilqr----------------------------------------------------------
PF00528         lllnlvadilqr----------------------------------------------------------