[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00433.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
   4::112  PF03610 0.0% 34.2592592592593  PTS system fructose IIA component 
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
PF03610         ---givivsHg.elAegllelaemiageqenviavggtpgegigtlaekieeaikeldsedevlvlvDlg


                         -         -         *         -         -         -         -:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLKIK------------------
PF03610         ggtpfneaallllekedievitglnlPlveeavaarasasle----------------------------