[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00441.1


[Show Plain Result]

## Summary of Sequence Search
   1::643
  91::309  PF00122 0.0% 25.6880733944954  E1-E2 ATPase 
 315::526  PF00702 0.0% 34.4444444444444  haloacid dehalogenase-like hydrolase 
 491::559  PF08282 0.0% 32.3529411764706  haloacid dehalogenase-like hydrolase 
   1::643


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLIKRMSPDEKKESGVIALCLMLLILAHFIPKNITIVLYIVTYIISAYPILKEAIENIFHGKWFDENFL
PF00122         ----------------------------------------------------------------------
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MSVATVGALAIGQFSEAIAVMLFYRVGEIFEDLAIENSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
PF00122         --------------------ilavllnalvefvqeykaekalesLkrlspetaatvirdgkeqeipakel
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
PF00122         vvGDiviiktGdrvpaDgrlieagslevdesaltGEslpvtksvaergnkvfsgtvvlsgegkaiVtatg
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
PF00122         keteigkiarlvqeaksaktplqkkldrlaklllilvlavailif.iislvtdvaeklleallialallv
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
PF00122         vaiPegLplavtltlavgaqrlakkgvlv-----------------------------------------
PF00702         ----------------------------------kavvfDkdGTLtdg......................
PF08282         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
PF00122         ----------------------------------------------------------------------
PF00702         .......eqpiaeaiveaakeaglsllakaeeveiatgrgvde..ieeillegkltdelilanegearav
PF08282         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
PF00122         ----------------------------------------------------------------------
PF00702         sagktavivaidgelvglialadqvrpdarealraLkkaGi.kvvllTgdnrataeavlkitglaaefdf
PF08282         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK
PF00122         ----------------------------------------------------------------------
PF00702         ivdsedvlgkpkpealekaleklglkpeevamvGDg----------------------------------
PF08282         sKgtalkklakalnisleeviafGDgeNDieMLelaglgvAmgn.aspevkaaAdyvtdsnnedGvaka-


                         -         -         -         *         -         -         -:630
query           IARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAILNALRLLKMKEENKKINKYPH
PF00122         ----------------------------------------------------------------------
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SKTEKYKVEVNEA---------------------------------------------------------
PF00122         ----------------------------------------------------------------------
PF00702         ----------------------------------------------------------------------
PF08282         ----------------------------------------------------------------------