[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00459.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
  10::157  PF09250 0.0% 35.8620689655172  Bifunctional DNA primase/polymerase, N-terminal 
 191::253  PF08708 0.0% 27.4193548387097  Primase C terminal 1 (PriCT-1) 
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDID
PF09250         ---------laarglaviPlkpgsKkPaspkgwkkattdpavirrwwkrn.aanigvatggsglvviDiD
PF08708         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFIDGVDLLSDFVVTSPSTNY
PF09250         tke..gadalaaleaageplpptltvrtpsgGrhlyfrvpdglelkrnalaatkggdkpgvDiradgngy
PF08708         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYRRYYTGYLIDEIVNGVDAGNRNNWIASIFGK
PF09250         vvapPsvhpegpYewvk-----------------------------------------------------
PF08708         --------------------------------------------------kragaveggRNctLfdlarr


                         -         -         -         +         -         -         -:280
query           LLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILKRFINE------------------------
PF09250         ----------------------------------------------------------------------
PF08708         layrgvdeerdwrravlalahalNsef.spPLpdsEvkaiakS---------------------------