[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00490.1


[Show Plain Result]

## Summary of Sequence Search
   1::197
  20::60   PF00440 0.0% 36.5853658536585  Bacterial regulatory proteins, tetR family 
   1::197


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHQNDLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
PF00440         -------------------lelfaekGyaattvreIAkeAGvskgalYrhFpsKeeLlla----------


                         -         -         *         -         -         -         -:140
query           QLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFYHKIKQILTRELLKRMEYLGI
PF00440         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KMSDEIPHEYIEEYAIGSMLNLSIYWLEKDNPEPPNEFAKIMMRTRTKAPLAFAVKE-------------
PF00440         ----------------------------------------------------------------------