[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00499.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
  47::65   PF00528 0.0% 26.3157894736842  Binding-protein-dependent transport system inner me 
 158::342  PF00528 0.0% 25.8620689655172  Binding-protein-dependent transport system inner me 
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEKLKLSPDSFEPLAKGEAQDNEKIAAPSLTFTQDVWLRLKKNKGAVVSLIVILLMVIVAFGSTPFINK
PF00528         ----------------------------------------------vlalviavlllnlvadilq-----
PF00528         ----------------------------------------------vlalviavlllnlvadilq-----


                         -         -         *         -         -         -         -:140
query           STLVKSQPQYANLPAKVPGLDAINGLNGKIKQGGVWVDAYAKNDVPKDKYFYLGTDYLGRSLAQRIIYGT
PF00528         ----------------------------------------------------------------------
PF00528         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KVSLIVALVATFFDLTVGVAYGIISGWKGGRVDNVMQRIIEIISSIPNLVIVVLMLVVLKPGMTSIILAI
PF00528         -----------------gillGilaalnrnkkldkllrpliivlsslPsfvlaillvlvfvilsilghli
PF00528         -----------------gillGilaalnrnkkldkllrpliivlsslPsfvlaillvlvfvilsilghli


                         -         -         -         +         -         -         -:280
query           AISSWTTMARMIRAETLSLKTQEYVLAARTLGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLS
PF00528         lp.viillllsaapyvrlirraalrslpkdlveaaralGasrwqifrkvvlPnalppiitglilafggll
PF00528         lp.viillllsaapyvrlirraalrslpkdlveaaralGasrwqifrkvvlPnalppiitglilafggll


                         -         *         -         -         -         -         +:350
query           FIGIGITAPETSLGVLLNEGQKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPKTRR--------
PF00528         ggavlleflgswpGlgtllleailgydyseis..........nggvlalviavlllnlvadi--------
PF00528         ggavlleflgswpGlgtllleailgydyseis..........nggvlalviavlllnlvadi--------